Description

  • Product name

    Recombinant Human NARS protein
  • Purity

    > 80 % SDS-PAGE.
    ab207154 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMVLAELYVSDREGSDATGDGTKEKPFK TGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKS ESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQR VKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTES SVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVD VQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQ VEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSR TRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHEL NPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLM TDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSM RIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWI LNRYHIRDVCLYPRFVQRCTP
    • Predicted molecular weight

      65 kDa including tags
    • Amino acids

      1 to 548
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_004530.

Specifications

Our Abpromise guarantee covers the use of ab207154 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • 3010001M15Rik
    • AA960128
    • AsnRS
    • ASNS
    • Asparagine tRNA ligase
    • Asparagine tRNA ligase 1, cytoplasmic
    • Asparagine--tRNA ligase
    • Asparaginyl tRNA synthetase
    • Asparaginyl-tRNA synthetase
    • C78150
    • cytoplasmic
    • EC 6.1.1.22
    • LRRGT00113
    • MGC116236
    • Nars
    • NARS1
    • NRS
    • SYNC_HUMAN
    see all
  • Sequence similarities

    Belongs to the class-II aminoacyl-tRNA synthetase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab207154.

References

ab207154 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207154.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up