Description

  • Product name

    Recombinant Human NASP protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MFLLLLHLQIKWRATINLLSVTEDGLHFVEYYLNRIIHLDVDSEAKKLLG LGQKHLVMGDIPAAVNAFQEAASLLGKKYGETANECGEAFFFYGKSLLEL ARMENGVLGNALEGVHVEEEEGEKTEDESLVENNDNIDEEAREELREQVY DAMGEKEEAKKTEDKSLAKPETDKEQDSEMEKGGREDMDISKSAEEPQEK VDLTLDWLTETSEEAKGGAAPEGPNEAEVTSGKPEQEVPDAEEEKSVSGT DVQEECREKGGQEKQGEVIVSIEEKPKEVSEEQPVVTLEKQGTAVEVEAE SLDPTVKPVDVGGDEPEEKVVTSENEAGKAVLEQLVGQEVPPAEESPEVT TEAAEASAVEAGSEVSEKPGQEAPVLPKDGAVNGPSVVGDQTPIEPQTSI ERLTETKDGSGLEEKVRAKLVPSQEETKLSVEESEAAGDGVDTKVAQGAT EKSPEDKVQIAANEETQEREEQMKEGEETEGSEEDDKENDKTEEMPNDSV LENKSLQENEEEEIGNLELAWDMLDLAKIIFKRQETKEAQLYAAQAHLKL GEVSVESENYVQAVEEFQSCLNLQEQYLEAHDRLLAETHYQLGLAYGYNS QYDEAVAQFSKSIEVIENRMAVLNEQVKEAEGSSAEYKKEIEELKELLPE IREKIEDAKESQRSGNVAELALKATLVESSTSGFTPGGGGSSVSMIASRK PTDGASSSNCVTDISHLVRKKRKPEEESPRKDDAKKAKQEPEVNGGSGDA VPSGNEVSENMEEEAENQAESRAAVEGTVEAGATVESTAC
    • Amino acids

      1 to 790
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 5033430J04Rik
    • AI131596
    • AI317140
    • D4Ertd767e
    • DKFZp547F162
    • Epcs32
    • FLB7527
    • FLJ31599
    • FLJ35510
    • MGC19722
    • MGC20372
    • MGC2297
    • MGC93869
    • NASP
    • NASP_HUMAN
    • Nuclear autoantigenic sperm protein
    • nuclear autoantigenic sperm protein (histone binding)
    • PRO1999
    • RP23 233B9.9
    see all
  • Function

    Required for DNA replication, normal cell cycle progression and cell proliferation. Forms a cytoplasmic complex with HSP90 and H1 linker histones and stimulates HSP90 ATPase activity. NASP and H1 histone are subsequently released from the complex and translocate to the nucleus where the histone is released for binding to DNA.
  • Tissue specificity

    Isoform 1 is testis- and sperm-specific.
  • Sequence similarities

    Belongs to the NASP family.
    Contains 3 TPR repeats.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab158955 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up