Description

  • Product name

    Recombinant Human NAT8 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAPCHVRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGP LALLLVSGSWLLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKS YLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVDSEHRR QGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSF FCVWARLVALHTVHFIYHLPSSKVGSQ
    • Amino acids

      1 to 227
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • acetyltransferase 2
    • ATase2
    • Camello, Xenopus, homolog of, 1
    • Camello-like protein 1
    • CML1
    • cysteinyl-conjugate N-acetyltransferase
    • GLA
    • Hcml1
    • kidney- and liver-specific gene product
    • N-acetyltransferase 8
    • N-acetyltransferase 8 (camello like)
    • N-acetyltransferase 8 (GCN5-related, putative)
    • NAT8
    • NAT8_HUMAN
    • Probable N-acetyltransferase 8
    • TSC501
    • TSC510
    see all
  • Function

    Plays a role in regulation of gastrulation.
  • Tissue specificity

    Expression is restricted to liver and kidney.
  • Sequence similarities

    Belongs to the camello family.
    Contains 1 N-acetyltransferase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab160299 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160299 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up