Recombinant Human Natriuretic Peptide Receptor A/GC-A protein (Tagged) (ab235810)

Description

  • Product name

    Recombinant Human Natriuretic Peptide Receptor A/GC-A protein (Tagged)
    See all Natriuretic Peptide Receptor A/GC-A proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GNLTVAVVLPLANTSYPWSWARVGPAVELALAQVKARPDLLPGWTVRTVL GSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVYAAAPVGRFTAHW RVPLLTAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQA LMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLL RTMPRKGRVIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQG GQGPAPRRPWERGDGQDVSARQAFQAAKIITYKDPDNPEYLEFLKQLKHL AYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQ RMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAFRVVLNYNGTSQE LVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLE
    • Predicted molecular weight

      65 kDa including tags
    • Amino acids

      33 to 473
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO-tagged. Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab235810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Natriuretic Peptide Receptor A. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • ANP-A
    • ANPa
    • ANPR-A
    • ANPRA
    • ANPRA_HUMAN
    • Atrial natriuretic peptide A type receptor
    • Atrial natriuretic peptide receptor 1
    • Atrial natriuretic peptide receptor A
    • Atrial natriuretic peptide receptor type A
    • Atrionatriuretic peptide receptor A
    • GC A
    • GC-A
    • Guanylate cyclase
    • Guanylate cyclase A
    • GUC2A
    • GUCY2A
    • Natriuretic peptide A type receptor
    • Natriuretic Peptide Receptor A
    • Natriuretic peptide receptor A/guanylate cyclase A
    • NPR-A
    • NPR1
    • NPRA
    see all
  • Function

    Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.
  • Sequence similarities

    Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
    Contains 1 guanylate cyclase domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylation of the protein kinase-like domain is required for full activation by ANP.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab235810.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235810 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) Natriuretic Peptide Receptor A/GC-A.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235810 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) Natriuretic Peptide Receptor A/GC-A.

References

ab235810 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up