For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-ncam1-protein-ab114198.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Cell Type Marker Neuron marker Growth Cone
Share by email

Recombinant Human NCAM1 protein (ab114198)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human NCAM1 protein (ab114198)

    Key features and details

    • Expression system: Wheat germ
    • Suitable for: WB, SDS-PAGE, ELISA

    You may also be interested in

    ELISA
    Product image
    Human NCAM1 ELISA Kit (CD56) (ab119587)

    View more associated products

    Description

    • Product name

      Recombinant Human NCAM1 protein
      See all NCAM1 proteins and peptides
    • Expression system

      Wheat germ
    • Accession

      P13591
    • Protein length

      Protein fragment
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEI RLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP
      • Predicted molecular weight

        37 kDa including tags
      • Amino acids

        611 to 710

    Associated products

      Specifications

      Our Abpromise guarantee covers the use of ab114198 in the following tested applications.

      The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

      • Applications

        Western blot

        SDS-PAGE

        ELISA

      • Form

        Liquid
      • Concentration information loading...

      Preparation and Storage

      • Stability and Storage

        Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

        pH: 8.00
        Constituents: 0.79% Tris HCl, 0.3% Glutathione

      General Info

      • Alternative names

        • antigen MSK39 identified by monoclonal antibody 5.1H11
        • antigen recognized by monoclonal antibody 5.1H11
        • CD56
        • cell adhesion molecule, neural, 1
        • MSK 39
        • MSK39
        • N-CAM-1
        • NCAM
        • NCAM 1
        • NCAM C
        • NCAM-1
        • NCAM1
        • NCAM1_HUMAN
        • NCAMC
        • Neural cell adhesion molecule 1
        • Neural cell adhesion molecule NCAM
        • OTTHUMP00000235666
        see all
      • Function

        This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc.
      • Sequence similarities

        Contains 2 fibronectin type-III domains.
        Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
      • Cellular localization

        Secreted and Cell membrane.
      • Target information above from: UniProt accession P13591 The UniProt Consortium
        The Universal Protein Resource (UniProt) in 2010
        Nucleic Acids Res. 38:D142-D148 (2010) .

        Information by UniProt

      Images

      • SDS-PAGE - Recombinant Human NCAM1 protein (ab114198)
        SDS-PAGE - Recombinant Human NCAM1 protein (ab114198)
        ab114198 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue

      Protocols

      To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

      Click here to view the general protocols

      Datasheets and documents

      • SDS download

      • Datasheet download

        Download

      References (0)

      Publishing research using ab114198? Please let us know so that we can cite the reference in this datasheet.

      ab114198 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab114198.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.