Overview

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRI SVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLM FKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVL SNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQN IVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDS SQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAM ELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHMVVRSHARVSS LTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEG NQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPD SENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQF DEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPE TTYAVRLAALNGKGLGEISAASEFKTQPVHSPPPH HHHHH
    • Molecular weight

      66 kDa including tags
    • Amino acids

      20 to 603
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab215600 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 0.87% Sodium chloride

    Lyophilized from a 0.2 µm filtered solution.

  • Reconstitution
    Dissolve the lyophilized protein in ddH2O. It is not recommended to reconstitute to a concentration less than 100 µg/ml.

General Info

  • Alternative names

    • antigen MSK39 identified by monoclonal antibody 5.1H11
    • antigen recognized by monoclonal antibody 5.1H11
    • CD56
    • cell adhesion molecule, neural, 1
    • MSK 39
    • MSK39
    • N-CAM-1
    • NCAM
    • NCAM 1
    • NCAM C
    • NCAM-1
    • NCAM1
    • NCAM1_HUMAN
    • NCAMC
    • Neural cell adhesion molecule 1
    • Neural cell adhesion molecule NCAM
    • OTTHUMP00000235666
    see all
  • Function

    This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc.
  • Sequence similarities

    Contains 2 fibronectin type-III domains.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab215600 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215600.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up