Overview

  • Product name

    Recombinant Human NCAPG2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MLLECFININYIKKEEGRRFLSCLFNWNINFIKMIHGTIKNQLQGLQKSL MVYIAEIYFRAWKKASGKILEAIENDCIQDFMFHGIHLPRRSPVHSKVRE VLSYFHHQKKVRQGVEEMLYRLYKPILWRGLKARNSEVRSNAALLFVEAF PIRDPNLHAIEMDSEIQKQFEELYSLLEDPYPMVRSTGILGVCKITSKYW EMMPPTILIDLLKKVTGELAFDTSSADVRCSVFKCLPMILDNKLSHPLLE QLLPALRYSLHDNSEKVRVAFVDMLLKIKAVRAAKFWKICPMEHILVRLE TDSRPVSRRLVSLIFNSFLPVNQPEEVWCERCVTLVQMNHAAARRFYQYA HEHTACTNIAKLIHVIRHCLNACIQRAVREPPEDEEEEDGREKENVTVLD KTLSVNDVACMAGLLEIIVILWKSIDRSMENNKEAKLYTINKFASVLPEY LKVFKDDRCKIPLFMLMSFMPASAVPPFSCGVISTLRSREEGAVDKSYCT LLDCLCSWGQVGHILELVDNWLPTEHAQAKSNTASKGRVQIHDTRPVKPE LALVYIEYLLTHPKNRECLLSAPRKKLNHLLKALETSKADLESLLQTPGG KPRGFSEAAAPRAFGLHCRLSIHLQHKFCSEGKVYLSMLEDTGFWLESKI LSFIQDQEEDYLKLHRVIYQQIIQTYLTVCKDVVMVGLGDHQFQMQLLQR SLGIMQTVKGFFYVSLLLDILKEITGSSLIQKTDSDEEVAMLLDTVQKVF QKMLECIARSFRKQPEEGLRLLYSVQRPLHEFITAVQSRHTDTPVHRGVL STLIAGPVVEISHQLRKVSDVEELTPPEHLSDLPPFSRCLIGIIIKSSNV VRSFLDELKACVASNDIEGIVCLTAAVHIILVINAGKHKSSKVREVAATV HRKLKTFMEITLEEDSIERFLYESSSRTLGELLNS
    • Amino acids

      1 to 935
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162880 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CAP G2
    • Chromosome associated protein G2
    • Condensin 2 complex subunit G2
    • FLJ20311
    • hCAP G2
    • Leucine zipper protein 5
    • LUZP5
    • More than blood homolog
    • MTB
    • NCAPG 2
    • Non SMC condensin II complex subunit G2
    • Non SMC condensin II complex, subunit G2
    see all
  • Relevance

    NCAPG2 is 1 of 3 non-SMC subunits that define condensin II. Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPG2 is 1 of 3 non-SMC subunits that defines condensin II.
  • Cellular localization

    nucleus

Images

  • ab162880 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162880 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162880.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up