Recombinant Human NCAPG2 protein (ab162881)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TKTGADVCRLWRIHQALYCFDYDLEESGEIKDMLLECFININYIKKEEGR RFLSCLFNWNINFIKMIHGTIKNQLQGLQKSLMVYIAEIYFRAWKKAS
    • Amino acids
      177 to 274
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAP G2
    • Chromosome associated protein G2
    • Condensin 2 complex subunit G2
    • FLJ20311
    • hCAP G2
    • Leucine zipper protein 5
    • LUZP5
    • More than blood homolog
    • MTB
    • NCAPG 2
    • Non SMC condensin II complex subunit G2
    • Non SMC condensin II complex, subunit G2
    see all
  • Relevance
    NCAPG2 is 1 of 3 non-SMC subunits that define condensin II. Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPG2 is 1 of 3 non-SMC subunits that defines condensin II.
  • Cellular localization
    nucleus

Images

  • ab162881 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up