Overview

  • Product name

    Recombinant Human NCAPH2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MNFIEAALLIQGSACVYSKKVEYLYSLVYQALDFISGKRRAKQLSSVQED RANGVASSGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPM ALVAPDEMEKNNNPLYSRQGEVLASRKDFRMNTCVPHPRGAFMLEPEGMS PMEPAGVSPMPGTQKDTGRTEEQPMEVSVCRSPVPALGFSQEPGPSPEGP MPLGGGEDEDAEEAVELPEASAPKAALEPKESRSPQQSAALPRRYMLRER EGAPEPASCVKETPDPWQSLDPFDSLESKPFKKGRPYSVPPCVEEALGQK RKRKGAAKLQDFHQWYLAAYADHADSRRLRRKGPSFADMEVLYWTHVKEQ LETLRKLQRREVAEQWLRPAEEDHLEDSLEDLGAADDFLEPEEYMEPEGA DPREAADLDAVPMSLSYEELVRRNVELFIATSQKFVQETELSQRIRDWED TVQPLLQEQEQHVPFDIHTYGDQLVSRFPQLNEWCPFAELVAGQPAFEVC RSMLASLQLANDYTVEITQQPGLEMAVDTMSLRLLTHQRAHKRFQTYAAP SMAQP
    • Molecular weight

      89 kDa including tags
    • Amino acids

      51 to 605

Specifications

Our Abpromise guarantee covers the use of ab132815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CAP H2
    • CAP H2 subunit of the condensin II complex
    • CAPH2
    • Chromosome associated protein H2
    • Chromosome-associated protein H2
    • CNDH2_HUMAN
    • Condensin-2 complex subunit H2
    • hCAP H2
    • hCAP-H2
    • Kleisin beta
    • Kleisin-beta
    • Ncaph2
    • Non SMC condensin II complex subunit H2
    • Non-SMC condensin II complex subunit H2
    see all
  • Function

    Regulatory subunit of the condensin-2 complex, a complex that seems to provide chromosomes with an additional level of organization and rigidity and in establishing mitotic chromosome architecture. May play a role in lineage-specific role in T-cell development.
  • Sequence similarities

    Belongs to the CND2 H2 (condensin-2 subunit 2) family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Chromosome. Distributed along the arms of chromosomes assembled in vivo and in vitro.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132815 stained with Coomassie Blue.

References

ab132815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up