Description

  • Product name

    Recombinant Human NCE2/UBE2F protein
    See all NCE2/UBE2F proteins and peptides
  • Purity

    > 95 % Densitometry.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPC TCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKC LTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDL LNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      1 to 185
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167934 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as NCE2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.00
    Preservative: 1.02% Imidazole
    Constituents: 0.002% PMSF, 0.82% Sodium phosphate, 0.004% DTT, 25% Glycerol, 1.75% Sodium chloride

General Info

  • Alternative names

    • NCE2
    • NEDD8 carrier protein UBE2F
    • NEDD8 conjugating enzyme
    • NEDD8 conjugating enzyme UBE2F
    • NEDD8 protein ligase UBE2F
    • NEDD8-conjugating enzyme 2
    • NEDD8-conjugating enzyme UBE2F
    • ube2f
    • UBE2F_HUMAN
    • Ubiquitin conjugating enzyme E2F
    • Ubiquitin conjugating enzyme E2F (putative)
    • Ubiquitin-conjugating enzyme E2 F
    see all
  • Function

    Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.
  • Tissue specificity

    Widely expressed (at protein level).
  • Pathway

    Protein modification; protein neddylation.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab167934.

References

ab167934 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167934.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up