Description

  • Product name

    Recombinant Human NCE2/UBE2F protein (His tag)
    See all NCE2/UBE2F proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPC TCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKC LTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDL LNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      1 to 185
    • Tags

      His tag N-Terminus
    • Additional sequence information

      AAH10549.

Specifications

Our Abpromise guarantee covers the use of ab220554 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as NCE2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • NCE2
    • NEDD8 carrier protein UBE2F
    • NEDD8 conjugating enzyme
    • NEDD8 conjugating enzyme UBE2F
    • NEDD8 protein ligase UBE2F
    • NEDD8-conjugating enzyme 2
    • NEDD8-conjugating enzyme UBE2F
    • ube2f
    • UBE2F_HUMAN
    • Ubiquitin conjugating enzyme E2F
    • Ubiquitin conjugating enzyme E2F (putative)
    • Ubiquitin-conjugating enzyme E2 F
    see all
  • Function

    Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.
  • Tissue specificity

    Widely expressed (at protein level).
  • Pathway

    Protein modification; protein neddylation.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab220554 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 23-25 kDa in SDS-PAGE.

References

ab220554 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220554.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up