Description

  • Product name

    Recombinant Human NCF1/p47-phox protein
  • Purity

    > 90 % SDS-PAGE.
    ab98054 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEF HKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCST LMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKDGKSTAT DITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKA KRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEG EAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPP RRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL EEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAVVEHHHHHH
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      1 to 390
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

    Western blot

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as NCF1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • 47 kDa autosomal chronic granulomatous disease protein
    • 47 kDa neutrophil oxidase factor
    • NADPH oxidase organizer 2
    • NCF 47K
    • NCF-1
    • NCF-47K
    • Ncf1
    • NCF1_HUMAN
    • Neutrophil cytosol factor 1
    • Neutrophil cytosolic factor 1
    • neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1)
    • Neutrophil NADPH oxidase factor 1
    • Nox organizer 2
    • Nox organizing protein 2
    • Nox-organizing protein 2
    • NOXO2
    • p47 phox
    • p47-phox
    • SH3 and PX domain containing protein 1A
    • SH3 and PX domain-containing protein 1A
    • SH3PXD1A
    see all
  • Function

    NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production).
  • Involvement in disease

    Defects in NCF1 are the cause of chronic granulomatous disease autosomal recessive cytochrome-b-positive type 1 (CGD1) [MIM:233700]. Chronic granulomatous disease is a genetically heterogeneous disorder characterized by the inability of neutrophils and phagocytes to kill microbes that they have ingested. Patients suffer from life-threatening bacterial/fungal infections.
  • Sequence similarities

    Contains 1 PX (phox homology) domain.
    Contains 2 SH3 domains.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab98054

References

ab98054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Vielen Dank für Ihre Anfrage. Gegen die genannten NADPH-Oxidase-Komponenten haben wir folgende Antikörper bzw. Proteine in unserem Katalog: Click here (or use the following: https://www.abcam.com/index.html?datasheet=109366). Click here (or use the following: https://www.abcam.com/index.html?datasheet=80508). Click here (or use the following: https://www.abcam.com/index.html?datasheet=33186). Click here (or use the following: https://www.abcam.com/index.html?datasheet=2244). Click here (or use the following: https://www.abcam.com/index.html?datasheet=118159). Click here (or use the following: https://www.abcam.com/index.html?datasheet=75941). Click here (or use the following: https://www.abcam.com/index.html?datasheet=115855). Click here (or use the following: https://www.abcam.com/index.html?datasheet=59355). Click here (or use the following: https://www.abcam.com/index.html?datasheet=111855). Click here (or use the following: https://www.abcam.com/index.html?datasheet=795). Click here (or use the following: https://www.abcam.com/index.html?datasheet=88031). Click here (or use the following: https://www.abcam.com/index.html?datasheet=98054). Click here (or use the following: https://www.abcam.com/index.html?datasheet=117065). Click here (or use the following: https://www.abcam.com/index.html?datasheet=114183). Click here (or use the following: https://www.abcam.com/index.html?datasheet=84657). Click here (or use the following: https://www.abcam.com/index.html?datasheet=40471). Click here (or use the following: https://www.abcam.com/index.html?datasheet=89246). Click here (or use the following: https://www.abcam.com/index.html?datasheet=82670). Click here (or use the following: https://www.abcam.com/index.html?datasheet=51014). Click here (or use the following: https://www.abcam.com/index.html?datasheet=84655). Click here (or use the following: https://www.abcam.com/index.html?datasheet=78684). Click here (or use the following: https://www.abcam.com/index.html?datasheet=87665). Vielleicht interessiert Sie in diesem Zusammenhang auch einer unserer Assaykits (NADP/NADPH): Click here (or use the following: https://www.abcam.com/index.html?datasheet=65349). Wir geben alle getesteten Spezies und Anwendungen auf unseren Produktdatenblättern an und aktualisieren diese sobald wir neue Informationen erhalten. Falls sich herausstellt, dass der Antikörper nicht so funktioniert, wie auf dem Datenblatt beschrieben und Sie sich innerhalb von sechs Monaten mit Ihrem Problem an uns wenden, werden wir Ihnen gerne Vorschläge zur Optimierung Ihres Protokolls oder gegebenenfalls einen Ersatz oder eine Gutschrift schicken. Falls der Antikörper in einer bisher nicht getesteten Anwendung oder Spezies verwendet wird (z.B. für ab111855 oder ab115855), qualifizieren Sie sich für unser Testprogramm: Bei diesem Angebot bekommen Sie einen 100%igen Rabatt für eine zukünftige Bestellung, wenn Sie uns ein Abreview mit dem Testresultat zusenden. Die Bedingungen zu unserem 100% Abreview Rabatt können Sie unter dem folgenden Link nachlesen: https://www.abcam.com/collaborationdiscount. Falls Sie daran interessiert sind oder weitere Fragen haben, kontaktieren Sie bitte unseren wissenschaftlichen Dienst. Die oben genannten Antikörper sind nur eine Auswahl und wir haben noch weitere gegen die entsprechenden Zielproteine erhältlich, die für unterschiedliche Anwendungen getestet und garantiert sind. Bei einer detaillierteren Suche bzw. Beratung bin ich Ihnen gerne weiter behilflich. Gerne senden wir Ihnen auch gerne ein Angebot zu, sobald Sie eine konkrete Auswahl getroffen haben. Ich hoffe, diese Informationen helfen Ihnen weiter. Bitte zögern Sie nicht, sich wieder bei uns zu melden, falls Sie weitere Fragen haben.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up