Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGY VPSNYVERKNSLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYP ANGSGADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTVMEKCSDGWWR GSYNGQIGWFPSNYVLEEVDEAAAESPSFLSLRKGASLSNGQGSRVLHVV QTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKN YVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALN ERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFH TMDELVEHYKKAPIFTSEHGEKLYLVRALQ
    • Molecular weight

      69 kDa including tags
    • Amino acids

      1 to 380

Specifications

Our Abpromise guarantee covers the use of ab132135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Protein previously labeled as Nck beta.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cytoplasmic protein NCK2
    • GRB4
    • Growth factor receptor bound protein 4
    • NCK adaptor protein 2
    • Nck-2
    • NCK2
    • NCK2_HUMAN
    • NCKbeta
    • Non-catalytic region of tyrosine kinase adaptor protein 2
    • Noncatalytic region of tyrosine kinase beta
    • SH2/SH3 adaptor protein NCK-beta
    see all
  • Function

    Adapter protein which associates with tyrosine-phosphorylated growth factor receptors or their cellular substrates. Maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 SH2 domain.
    Contains 3 SH3 domains.
  • Cellular localization

    Cytoplasm. Endoplasmic reticulum.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab13135 stained with Coomassie Blue.

References

ab132135 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up