Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESA AYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVG RDDFDDADQLWIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAI SGFGLSLIKWILIVRSSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYA KVRKMPETFSNLPRTRVLFIY
    • Amino acids

      1 to 221
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153526 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 0610010M22Rik
    • Breast cancer associated protein SGA 1M
    • Breast cancer-associated protein SGA-1M
    • MGC10924
    • N4WBP5
    • Ndfip1
    • Nedd4 family interacting protein 1
    • NEDD4 family-interacting protein 1
    • NEDD4 WW domain binding protein 5
    • NEDD4 WW domain-binding protein 5
    • NFIP1_HUMAN
    • Putative MAPK activating protein PM13
    • Putative MAPK-activating protein PM13
    • Putative NF kappa B activating protein 164
    • Putative NF-kappa-B-activating protein 164
    • Putative NFKB and MAPK activating protein
    • Putative NFKB and MAPK-activating protein
    see all
  • Function

    Activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH, and consequently modulates the stability of their targets. As a result, controls many cellular processes. Prevents chronic T-helper cells-mediated inflammation by activating ITCH and thus controlling JUNB degradation (By similarity). In cortical neurons, mediates the ubiquitination of SLC11A2/DMT1 by NEDD4L, leading to down-regulation of the divalent metal transporter and protection of the cells from cobalt and iron toxicity. Modulates EGFR signaling through multiple pathways. In particular, may regulate the ratio of AKT1-to-MAPK8 signaling in response to EGF, acting on AKT1 probably through PTEN destabilization and on MAPK8 through ITCH-dependent MAP2K4 inactivation. As a result, may control cell growth rate.
  • Tissue specificity

    Widely expressed. Higher levels are detected in cerebellum, pituitary, thalamus, kidney, liver, testis, salivary glands and placenta. Also expressed in fetal brain, kidney and lung.
  • Domain

    The PY (WW-binding) motifs are required for E3 ubiquitin-protein ligase binding and activation and for ubiquitination.
  • Post-translational
    modifications

    Ubiquitinated by NEDD4 and ITCH; mono-, di- and polyubiquitinated forms are detected. Ubiquitination regulates its degradation.
    Undergoes transient tyrosine phosphorylation following EGF stimulation, most probably by catalyzed by SRC. Phosphorylation SRC is enhanced in the presence of NDFIP2 which may act as a scaffold to recruit SRC to NDFIP1.
  • Cellular localization

    Endosome membrane. Golgi apparatus membrane. Secreted. Detected in exosomes and secreted via the exosomal pathway.
  • Information by UniProt

Images

  • ab153526 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153526 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153526.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up