Recombinant Human Ndfip1 protein (His tag) (ab174406)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant Human Ndfip1 protein (His tag) -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMGSMALALAALAAVEPACGSRYQQLQNEEE SGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYD EAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDG -
Predicted molecular weight
15 kDa including tags -
Amino acids
1 to 116 -
Tags
His tag N-Terminus -
Additional sequence information
Cytoplasmic domain (NP_085048).
-
Associated products
-
Corresponding Antibody
Specifications
Our Abpromise guarantee covers the use of ab174406 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride
General Info
-
Alternative names
- 0610010M22Rik
- Breast cancer associated protein SGA 1M
- Breast cancer-associated protein SGA-1M
see all -
Function
Activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH, and consequently modulates the stability of their targets. As a result, controls many cellular processes. Prevents chronic T-helper cells-mediated inflammation by activating ITCH and thus controlling JUNB degradation (By similarity). In cortical neurons, mediates the ubiquitination of SLC11A2/DMT1 by NEDD4L, leading to down-regulation of the divalent metal transporter and protection of the cells from cobalt and iron toxicity. Modulates EGFR signaling through multiple pathways. In particular, may regulate the ratio of AKT1-to-MAPK8 signaling in response to EGF, acting on AKT1 probably through PTEN destabilization and on MAPK8 through ITCH-dependent MAP2K4 inactivation. As a result, may control cell growth rate. -
Tissue specificity
Widely expressed. Higher levels are detected in cerebellum, pituitary, thalamus, kidney, liver, testis, salivary glands and placenta. Also expressed in fetal brain, kidney and lung. -
Domain
The PY (WW-binding) motifs are required for E3 ubiquitin-protein ligase binding and activation and for ubiquitination. -
Post-translational
modificationsUbiquitinated by NEDD4 and ITCH; mono-, di- and polyubiquitinated forms are detected. Ubiquitination regulates its degradation.
Undergoes transient tyrosine phosphorylation following EGF stimulation, most probably by catalyzed by SRC. Phosphorylation SRC is enhanced in the presence of NDFIP2 which may act as a scaffold to recruit SRC to NDFIP1. -
Cellular localization
Endosome membrane. Golgi apparatus membrane. Secreted. Detected in exosomes and secreted via the exosomal pathway. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human Ndfip1 protein (His tag) (ab174406)15% SDS-PAGE analysis of ab174406 at 3μg. Note: Molecular size on SDS-PAGE will appear higher than calculated.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab174406 has not yet been referenced specifically in any publications.
