Overview

  • Product name

    Recombinant Human NDP52 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIP RRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPK DDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNK ELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKE QKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQG DQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQ QELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMG LDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPIC KADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL
    • Molecular weight

      79 kDa including tags
    • Amino acids

      1 to 446

Specifications

Our Abpromise guarantee covers the use of ab132609 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Antigen nuclear dot 52 kDa protein
    • CACO2_HUMAN
    • Calcium binding and coiled coil domain 2
    • Calcium binding and coiled coil domain containing protein 2
    • Calcium-binding and coiled-coil domain-containing protein 2
    • CALCOCO 2
    • CALCOCO2
    • MGC17318
    • NDP52
    • Nuclear domain 10 protein
    • Nuclear domain 10 protein 52
    • Nuclear domain 10 protein NDP52
    • Nuclear domain protein 52
    • Nuclear dot protein 52
    • OTTHUMP00000218344
    • OTTHUMP00000218345
    • OTTHUMP00000218346
    • OTTHUMP00000218347
    • OTTHUMP00000218349
    • OTTHUMP00000218351
    see all
  • Function

    May play a role in ruffle formation and actin cytoskeleton organization. Seems to negatively regulate constitutive secretion.
  • Tissue specificity

    Expressed in all tissues tested with highest expression in skeletal muscle and lowest in brain.
  • Cellular localization

    Cytoplasm > perinuclear region. Golgi apparatus. Cytoplasm > cytoskeleton. According to PubMed:7540613, localizes to nuclear dots. According to PubMed:9230084 and PubMed:12869526, it is not a nuclear dot-associated protein but localizes predominantly in the cytoplasm with a coarse-grained distribution preferentially close to the nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132609 stained with Coomassie Blue.

References

ab132609 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132609.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up