Recombinant Human NDST3 protein (ab160446)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: WB, ELISA
Description
-
Product name
Recombinant Human NDST3 protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
IGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLE KGSLPGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIH -
Amino acids
162 to 259 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab160446 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Bifunctional heparan sulfate N deacetylase/N sulfotransferase 3
- Glucosaminyl N deacetylase/N sulfotransferase 3
- Glucosaminyl N-deacetylase/N-sulfotransferase 3
see all -
Function
Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Has high deacetylase activity but low sulfotransferase activity. -
Tissue specificity
Expressed in brain, kidney, liver, fetal and adult lung, adult pancreas, placenta, fetal spleen and fetal thymus. Not detected in adult/ fetal heart and skeletal muscle. -
Pathway
Glycan metabolism; heparan sulfate biosynthesis.
Glycan metabolism; heparin biosynthesis. -
Sequence similarities
Belongs to the sulfotransferase 1 family. NDST subfamily. -
Cellular localization
Golgi apparatus membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab160446 has not yet been referenced specifically in any publications.