Description

  • Product name

    Recombinant Human NDUFA1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
    • Amino acids

      24 to 70
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CI MWFE
    • CI-MWFE
    • Complex I MWFE
    • complex I MWFE subunit
    • Complex I-MWFE
    • MWFE
    • MWFE, B. taurus, homolog of
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 1
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 1 7.5kDa
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
    • NADH oxidoreductase subunit MWFE
    • NADH ubiquinone oxidoreductase (complex 1)
    • NADH ubiquinone oxidoreductase MWFE subunit
    • NADH-ubiquinone oxidoreductase 1 alpha subcomplex, 1
    • NADH-ubiquinone oxidoreductase MWFE subunit
    • NDUA1_HUMAN
    • NDUFA 1
    • NDUFA1
    • Type I dehydrogenase
    • ZNF 183
    • ZNF183
    see all
  • Function

    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Tissue specificity

    Primarily expressed in heart and skeletal muscle.
  • Involvement in disease

    Defects in NDUFA1 are a cause of mitochondrial complex I deficiency (MT-C1D) [MIM:252010]. A disorder of the mitochondrial respiratory chain that causes a wide range of clinical disorders, from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease.
  • Sequence similarities

    Belongs to the complex I NDUFA1 subunit family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab158959 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158959 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up