Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMER DRRISGVDRYYVSKGLENID
    • Amino acids
      1 to 70
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CI MWFE
    • CI-MWFE
    • Complex I MWFE
    • complex I MWFE subunit
    • Complex I-MWFE
    • MWFE
    • MWFE, B. taurus, homolog of
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 1
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 1 7.5kDa
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
    • NADH oxidoreductase subunit MWFE
    • NADH ubiquinone oxidoreductase (complex 1)
    • NADH ubiquinone oxidoreductase MWFE subunit
    • NADH-ubiquinone oxidoreductase 1 alpha subcomplex, 1
    • NADH-ubiquinone oxidoreductase MWFE subunit
    • NDUA1_HUMAN
    • NDUFA 1
    • NDUFA1
    • Type I dehydrogenase
    • ZNF 183
    • ZNF183
    see all
  • Function
    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Tissue specificity
    Primarily expressed in heart and skeletal muscle.
  • Involvement in disease
    Defects in NDUFA1 are a cause of mitochondrial complex I deficiency (MT-C1D) [MIM:252010]. A disorder of the mitochondrial respiratory chain that causes a wide range of clinical disorders, from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease.
  • Sequence similarities
    Belongs to the complex I NDUFA1 subunit family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab158960 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up