Overview

  • Product name

    Recombinant Human NDUFA2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAAAAASRGVGAKLGLREIRIHLCQRS PGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNV PLNNFSADQVTRALENVLSGKA
    • Molecular weight

      13 kDa including tags
    • Amino acids

      1 to 99
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab134615 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • B8
    • CI B8
    • CI-B8
    • Complex I B8
    • Complex I-B8
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 2
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 2 8kDa
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
    • NADH ubiquinone oxidoreductase B8 subunit
    • NADH-ubiquinone oxidoreductase B8 subunit
    • NDUA2_HUMAN
    • NDUFA 2
    • Ndufa2
    see all
  • Function

    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134615.

References

ab134615 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up