Overview

  • Product name
    Recombinant Human NDUFA7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLS NNYYCTRDGRRESVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPP IKRWELSSDQPYL
    • Amino acids
      1 to 113
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158964 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B14.5a
    • CI-B14.5a
    • Complex I B14.5a
    • Complex I-B14.5a
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 7 14.5kDa
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
    • NADH ubiquinone oxidoreductase subunit B14.5a
    • NADH-ubiquinone oxidoreductase subunit B14.5a
    • NDUA7_HUMAN
    • NDUFA7
    see all
  • Function
    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities
    Belongs to the complex I NDUFA7 subunit family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab158964 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158964 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158964.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up