Description

  • Product name

    Recombinant Human NDUFAB1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQP ALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSV NSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPYIDAEKLMCPQEIVDYIAD KKDVYE
    • Amino acids

      1 to 156
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ACP
    • ACPM_HUMAN
    • Acyl carrier protein
    • Acyl carrier protein mitochondrial
    • CI SDAP
    • CI-SDAP
    • FASN 2A
    • FASN2A
    • MGC65095
    • mitochondrial
    • Mitochondrial acyl carrier protein
    • NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1
    • NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1 8kDa
    • NADH ubiquinone oxidoreductase 9.6 kDa subunit
    • NADH ubiquinone oxidoreductase SDAP subunit
    • NADH-ubiquinone oxidoreductase 9.6 kDa subunit
    • NDUFAB 1
    • ndufab1
    • SDAP
    see all
  • Function

    Carrier of the growing fatty acid chain in fatty acid biosynthesis in mitochondria. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain.
  • Sequence similarities

    Contains 1 acyl carrier domain.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • ab158967 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up