Recombinant Human NDUFAF5 protein (ab163983)

Overview

  • Product name
    Recombinant Human NDUFAF5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFGGDTLYELRCSLQLAETEREGGFSPHISPFTAVNDLGHLLGRAGFNTL TVDTDEIQVNYPGMFELMEDLQGMGESNCAWNRKALLHRDTMLAAAAVYR EMYRNEDGSVPATYQIYYMIGWKYHESQARPAERGSATVSFGELGKINNL MPPGKKSQ
    • Amino acids
      1 to 158
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C20orf7
    • chromosome 20 open reading frame 7
    • CT007_HUMAN
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5
    • NDUFAF5
    • Probable methyltransferase C20orf7, mitochondrial
    see all
  • Function
    Putative methyltransferase involved in mitochondrial complex I assembly at early stages.
  • Involvement in disease
    Defects in C20orf7 are a cause of mitochondrial complex I deficiency (MT-C1D) [MIM:252010]. A disorder of the mitochondrial respiratory chain that causes a wide range of clinical disorders, from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease.
  • Sequence similarities
    Belongs to the methyltransferase superfamily.
  • Cellular localization
    Mitochondrion inner membrane. Peripherally localized on the matrix face of the mitochondrial inner membrane.
  • Information by UniProt

Images

  • ab163983 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up