Overview

  • Product name
    Recombinant Human NDUFB11 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPE PTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILV LGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLP EDE
    • Amino acids
      1 to 153
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CI ESSS
    • Complex I ESSS
    • complex I NP17.3 subunit
    • ESSS
    • FLJ20494
    • MGC111182
    • NADH dehydrogenase (ubiquinone) 1 beta subcomplex 11
    • NADH dehydrogenase (ubiquinone) 1 beta subcomplex 11 17.3kDa
    • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11
    • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11 mitochondrial
    • NADH ubiquinone oxidoreductase ESSS subunit
    • NDUFB 11
    • Neuronal protein 17.3
    • Np15
    • NP17.3
    • P17.3
    see all
  • Relevance
    NDUFB11 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11) is a component of the mitochondrial complex 1. Mammalian complex I is the first enzyme complex in the electron transport chain of mitochondria. It is composed of 45 different subunits. Complex I transfers electrons from NADH to the respiratory chain via ubiquinone.
  • Cellular localization
    Mitochondrion inner membrane.

Images

  • ab162774 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162774 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up