Overview

  • Product name
    Recombinant Human NDUFB9 protein (denatured)
  • Protein length
    Full length protein
  • Description
    Recombinant Human NDUFB9 protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAFLASGPYLTHQQKVLRLYKRALRHL ESWCVQRDKYRYFACLMRARFEEHKNEKDMAKATQLLKEAEEEFWYRQHP QPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKK LRRESWEREVKQLQEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRER PM
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 179
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171600 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • B22
    • CI B22
    • CI-B22
    • complex I B22 subunit
    • Complex I-B22
    • DKFZp566O173
    • FLJ22885
    • I B22
    • LYR motif containing protein 3
    • LYR motif-containing protein 3
    • LYRM3
    • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa
    • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
    • NADH ubiquinone oxidoreductase B22 subunit
    • NADH-ubiquinone oxidoreductase B22 subunit
    • NDUB9_HUMAN
    • Ndufb9
    • UQOR22
    see all
  • Function
    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities
    Belongs to the complex I LYR family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab171600.

References

ab171600 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171600.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up