Overview

  • Product name

    Recombinant Human NDUFC2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRR PIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDF PEEDKKTYGEIFEKFHPIR
    • Amino acids

      1 to 119
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • B14.5b
    • CI-B14.5b
    • Complex I B14.5b
    • Complex I subunit B14.5b
    • Complex I-B14.5b
    • HLC-1
    • HLC1
    • Human lung cancer oncogene 1 protein
    • NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa
    • NADH dehydrogenase [ubiquinone] 1 subunit C2
    • NADH dehydrogenase ubiquinone 1 subunit C2
    • NADH ubiquinone oxidoreductase subunit B14.5b
    • NADH-ubiquinone oxidoreductase subunit B14.5b
    • NADHDH2
    • NDUC2_HUMAN
    • NDUFC2
    see all
  • Function

    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities

    Belongs to the complex I NDUFC2 subunit family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab158976 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158976 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up