Description

  • Product name

    Recombinant Human NDUFS3 protein
  • Purity

    > 85 % SDS-PAGE.
    ab136706 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMESAGADTRPTVRPRNDVAHKQLSAFGEYV AEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLT AVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANW YEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDE VKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
    • Predicted molecular weight

      29 kDa including tags
    • Amino acids

      37 to 264
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab136706 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • CI 30
    • CI 30KD
    • CI-30kD
    • Complex I 30KD
    • Complex I 30kDa subunit
    • COMPLEX I, MITOCHONDRIAL RESPIRATORY CHAIN, 30-KD SUBUNIT
    • Complex I-30kD
    • mitochondrial
    • NADH coenzyme Q reductase
    • NADH dehydrogenase (ubiquinone) Fe S protein 3 30kDa
    • NADH dehydrogenase [ubiquinone] iron sulfur protein 3 mitochondrial
    • NADH dehydrogenase [ubiquinone] iron-sulfur protein 3
    • NADH dehydrogenase ubiquinone 30 kDa subunit
    • NADH-ubiquinone oxidoreductase 30 kDa subunit
    • NADH-Ubiquinone Oxidoreductase Fe-S Protein 3
    • NDUFS3
    • NDUS3_HUMAN
    see all
  • Function

    Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities

    Belongs to the complex I 30 kDa subunit family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab136706.

References

ab136706 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab136706.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up