Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKD YRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVY INLDKETKTGTCGYCGLQFRQHHH
    • Amino acids
      1 to 124
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BC059730
    • CI 13kA
    • CI 13kD A
    • CI-13kD-A
    • CI13KDA
    • Complex I 13kD A
    • Complex I 13kDa subunit A
    • Complex I mitochondrial respiratory chain 13 kD subunit
    • Complex I-13kD-A
    • IP13
    • MGC107676
    • NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH coenzyme Q reductase)
    • NADH dehydrogenase [ubiquinone] iron sulfur protein 6, mitochondrial
    • NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
    • NADH ubiquinone oxidoreductase 13 kDa A subunit
    • NADH-ubiquinone oxidoreductase 13 kDa-A subunit
    • NADH:ubiquinone oxidoreductase NDUFS6 subunit
    • NADH:ubiquinone oxidoreductase subunit S6
    • Ndufs6
    • NDUS6_HUMAN
    see all
  • Function
    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities
    Belongs to the complex I NDUFS6 subunit family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab158980 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158980 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158980.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up