Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYS YSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR
    • Amino acids
      114 to 213
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CI 20
    • CI-20kD
    • Complex I 20kDa subunit
    • Complex I mitochondrial respiratory chain 20 KD subunit
    • Complex I-20kD
    • FLJ45860
    • FLJ46880
    • MGC120002
    • MY017
    • NADH coenzyme Q reductase
    • NADH dehydrogenase (ubiquinone) Fe S protein 7 20kDa (NADH coenzyme Q reductase)
    • NADH dehydrogenase (ubiquinone) FeS protein 7, 20kDa (NADHcoenzyme Q reductase)
    • NADH dehydrogenase (ubiquinone) FeS protein7, 20kDa (NADHcoenzyme Q reductase)
    • NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
    • NADH-ubiquinone oxidoreductase 20 kDa subunit
    • NADH:ubiquinone oxidoreductase PSST subunit
    • NADHcoenzyme Q reductase
    • Ndufs7
    • NDUS7_HUMAN
    • PSST
    • PSST subunit
    see all
  • Function
    Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Involvement in disease
    Leigh syndrome
    Mitochondrial complex I deficiency
  • Sequence similarities
    Belongs to the complex I 20 kDa subunit family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab166358 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166358 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up