Overview

  • Product name
    Recombinant Human NECAB1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEDSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEE FKAYFADGVLSGEELHELFHTIDTHNTNNLDTEELCEYFSQHLGEYENVL AALEDLNLSILKAMGKTKKDYQEASNLEQFVTRFLLKETLNQLQSLQNSL ECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSPQF NVSGPGLLEEDNQWMTQINRLQKLIDRLEKKDLKLEPPEEEIIEGNTKSH IMLVQRQMSVIEEDLEEFQLALKHYVESASSQSGCLRISIQKLSNESRYM IYEFWENSSVWNSHLQTNYSKTFQRSNVDFLETPELTSTMLVPASWWILN N
    • Amino acids
      1 to 351
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163796 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EF-hand calcium-binding protein 1
    • EFCBP1
    • N-terminal EF-hand calcium-binding protein 1
    • NECA1_HUMAN
    • Necab1
    • neuronal calcium binding protein
    • Neuronal calcium-binding protein 1
    • STIP-1
    • synaptotagmin interacting protein 1
    see all
  • Tissue specificity
    Expressed in brain (at protein level).
  • Sequence similarities
    Contains 1 ABM domain.
    Contains 2 EF-hand domains.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab163796 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163796 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163796.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up