Overview

  • Product name
    Recombinant Human NECAP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRIT SKGKTAYIKLEDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGT GRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQESEISKESQEMDARPKLD LGFKEGQTIKLCIGNITNKKGGASKPRTARGGGLSLLPPPPGGKVTIPPP SSSVAISNHVTPPPIPKSNHGGSDADILLDLDSPAPVTTPAPTPVSVSND LWGDFSTASSSVPNQAPQPSNWVQF
    • Amino acids
      1 to 275
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adaptin ear binding coat associated protein 1
    • Adaptin ear-binding coat-associated protein 1
    • DKFZP566B183
    • MGC131900
    • NECAP 1
    • NECAP endocytosis associated 1
    • NECAP endocytosis-associated protein 1
    • NECAP-1
    • NECAP1
    • NECP1_HUMAN
    see all
  • Function
    Involved in endocytosis.
  • Sequence similarities
    Belongs to the NECAP family.
  • Domain
    The WXXF motifs mediate binding of accessory proteins to the ear-domain of AP-1, GGAs and AP-2 through hydrophobic interactions. Selective binding to the GAE domains of AP-1 or to the alpha-ear domain of AP-2 is tuned by the acidic context surrounding the motif and the properties of the second residue of the motif itself. The WXXF motif 1, which is preceded by an acidic residue and has a glycine in second position mediates specific interaction with AP-1. The WXXF motif 2, which is followed by the C-terminal carboxyl group negative charge, allows specific interaction with AP-2.
  • Cellular localization
    Cytoplasmic vesicle > clathrin-coated vesicle membrane. Cell membrane. Colocalizes with AP-2 at the plasma membrane.
  • Information by UniProt

Images

  • ab161852 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161852 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161852.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up