Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEQDVRVQVLPEVRGQLGGTVELP CHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERL SFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGM TWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWE AKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPV TLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTF PTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETP
    • Molecular weight
      38 kDa including tags
    • Amino acids
      32 to 350
    • Tags
      His-T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169910 was expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and glycerol.

General Info

  • Alternative names
    • CD 112
    • CD112
    • CD112 antigen
    • Herpes virus entry mediator B
    • Herpes virus entry protein B
    • Herpesvirus entry mediator B
    • Herpesvirus entry protein B
    • Hve B
    • HveB
    • Nectin-2
    • Nectin2
    • Poliovirus receptor like 2
    • Poliovirus receptor related 2
    • Poliovirus receptor related 2 (herpesvirus entry mediator B)
    • Poliovirus receptor related protein 2
    • Poliovirus receptor-related protein 2
    • PRR 2
    • PRR2
    • PVRL 2
    • PVRL2
    • PVRL2_HUMAN
    • PVRR 2
    • PVRR2
    see all
  • Function
    Probable cell adhesion protein.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the nectin family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab169910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up