Recombinant human Nectin 2 protein (Fc Chimera Active) (ab221406)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Fc tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE, ELISA
Description
-
Product name
Recombinant human Nectin 2 protein (Fc Chimera Active)
See all Nectin 2 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized ab221406 at 10 μg/mL (100 μL/well) can bind Biotinylated Human TIGIT, Fc Tag, Avi Tag with a linear range of 0.156-2.5 μg/mL.
Measured by its binding ability in a functional ELISA. Immobilized Human PVRIG at 2 μg/mL (100 μL/well) can bind ab221406 with a linear range of 0.2-3 ng/mL.
Measured by its binding ability in a BLI assay. Loaded ab221406 on Protein A Biosensor, can bind Human PVRIG with an affinity constant of 0.456 μM as determined in BLI assay.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQN VAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLT VEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVA LCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRA DGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATL SCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTV TNAVGMGRAEQVIFVRETPRASPRDVGPL -
Predicted molecular weight
62 kDa including tags -
Amino acids
32 to 360 -
Tags
Fc tag C-Terminus -
Additional sequence information
Fused with a Human IgG1 Fc tag (Pro 100 - Lys 330; P01857) at the C-terminus (AAH03091).
-
Specifications
Our Abpromise guarantee covers the use of ab221406 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
ELISA
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.
pH: 7.4
Constituents: 5% Trehalose, 0.61% Tris, 0.75% Glycine, 0.44% L-Arginine, 0.87% Sodium chloride
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- CD 112
- CD112
- CD112 antigen
see all -
Function
Probable cell adhesion protein. -
Tissue specificity
Ubiquitous. -
Sequence similarities
Belongs to the nectin family.
Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
Images
-
Immobilized ab221406 at 10 μg/mL (100 μL/well) can bind Biotinylated Human TIGIT, Fc Tag, Avi Tag with a linear range of 0.156-2.5 μg/mL.
-
Loaded ab221406 on Protein A Biosensor, can bind Human PVRIG with an affinity constant of 0.456 μM as determined in BLI assay.
-
Immobilized Human PVRIG at 2 μg/mL (100 μL/well) can bind ab221406 with a linear range of 0.2-3 ng/mL.
-
SDS-PAGE analysis of reduced ab221406 stained overnight with Coomassie Blue. The reduced protein migrates as 70-80 kDa in SDS-PAGE due to glycosylation.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab221406 has not yet been referenced specifically in any publications.