Bioactive grade

Recombinant human Nectin 2 protein (Fc Chimera Active) (ab221406)

Description

  • Product name

    Recombinant human Nectin 2 protein (Fc Chimera Active)
    See all Nectin 2 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab221406 at 10 μg/ml (100 μl/well) can bind Biotinylated Human TIGIT, Avi Tag with a linear range of 0.6-5 μg/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQN VAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLT VEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVA LCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRA DGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATL SCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTV TNAVGMGRAEQVIFVRETPRASPRDVGPL
    • Predicted molecular weight

      62 kDa including tags
    • Amino acids

      32 to 360
    • Additional sequence information

      Fused with a Human IgG1 Fc tag (Pro 100 - Lys 330; P01857) at the C-terminus (AAH03091).

Specifications

Our Abpromise guarantee covers the use of ab221406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 5% Trehalose, 0.61% Tris, 0.75% Glycine, 0.44% L-Arginine, 0.87% Sodium chloride

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD 112
    • CD112
    • CD112 antigen
    • Herpes virus entry mediator B
    • Herpes virus entry protein B
    • Herpesvirus entry mediator B
    • Herpesvirus entry protein B
    • Hve B
    • HveB
    • Nectin-2
    • Nectin2
    • Poliovirus receptor like 2
    • Poliovirus receptor related 2
    • Poliovirus receptor related 2 (herpesvirus entry mediator B)
    • Poliovirus receptor related protein 2
    • Poliovirus receptor-related protein 2
    • PRR 2
    • PRR2
    • PVRL 2
    • PVRL2
    • PVRL2_HUMAN
    • PVRR 2
    • PVRR2
    see all
  • Function

    Probable cell adhesion protein.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the nectin family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • Immobilized ab221406 at 10 μg/mL (100 μL/well) can bind Biotinylated Human TIGIT, Fc Tag, Avi Tag with a linear range of 0.156-2.5 μg/mL 

  • Immobilized Human PVRIG at 2 μg/mL (100 μL/well) can bind ab221406 with a linear range of 0.2-3 ng/mL

  • SDS-PAGE analysis of reduced ab221406 stained overnight with Coomassie Blue.

    The reduced protein migrates as 70-80 kDa in SDS-PAGE due to glycosylation.

References

ab221406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up