Recombinant Human Nectin 3 protein (ab153787)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, HPLC
Description
-
Product name
Recombinant Human Nectin 3 protein
See all Nectin 3 proteins and peptides -
Purity
> 95 % SDS-PAGE.
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Lyophilized from a 0.2 µM filtered solution. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GPIIVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHP QYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGN AQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWE GDLGEMESTTTSFPNETATIISQYKLFPTRFARGRRITCVVKHQALEKDI RYSFILDIQYAPEVSVTGYDGNWFVGRKGVNLKCNADANPPPFKSVWSRL DGQWPDGLLASDNTLHFVHPLTFNYSGVYICKVTNSLGQRSDQKVIYISA YNSVASLNCVDHHHHHH -
Predicted molecular weight
35 kDa including tags -
Amino acids
58 to 366 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab153787 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Additional notes
Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C. Please see notes section.
pH: 7.40
Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
General Info
-
Alternative names
- CD113
- CDw113
- DKFZP566B0846
see all -
Function
Plays a role in cell-cell adhesion through heterophilic trans-interactions with nectin-like proteins or nectins, such as trans-interaction with PVRL2/nectin-2 at Sertoli-spermatid junctions. Trans-interaction with PVR induces activation of CDC42 and RAC small G proteins through common signaling molecules such as SRC and RAP1. Also involved in the formation of cell-cell junctions, including adherens junctions and synapses. Induces endocytosis-mediated down-regulation of PVR from the cell surface, resulting in reduction of cell movement and proliferation. Plays a role in the morphology of the ciliary body. -
Tissue specificity
Predominantly expressed in testis and placenta as well as in many cell lines, including epithelial cell lines. -
Sequence similarities
Belongs to the nectin family.
Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab153787 has not yet been referenced specifically in any publications.