Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLY VADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLT RDDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRSHKSRVKGFLRLKM AYMPKNGGQDEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPPLPPGWE EKVDNLGRTYYVNHNNRTTQWHRPSLMDVSSESDNNIRQINQEAAHRRFR SRRHISEDLEPEPSEGGDVPEPWETISEEVNIAGDSLGLALPPPPASPGS RTSPQELSEELSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDAVAEQ GHLPPLAEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDS PVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPF FIDHNTKTTTWEDPRLKFPVHMRSKTSLNPNDLGPLPPGWEERIHLDGRT FYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRKKLKKPADI PNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVA REWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIG RVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWIL ENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQW RFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWR QHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFA ELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMA VENAQGFEGVD
    • Molecular weight

      131 kDa including tags
    • Amino acids

      1 to 911

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • E3 ubiquitin protein ligase NEDD4 like protein
    • E3 ubiquitin-protein ligase NEDD4-like
    • KIAA0439
    • NED4L_HUMAN
    • NEDD4 2
    • NEDD4 2c
    • Nedd4-2
    • NEDD4-2a
    • NEDD4.2
    • NEDD4b
    • NEDD4L
    • NEDD4La
    • NEDD4Lb
    • NEDD4Lc
    • NEDD4Ld
    • NEDD4Le
    • NEDD4Lf
    • NEDD4Lg
    • NEDD4Lh
    • NEDL3
    • Neural precursor cell expressed developmentally down regulated 4 like E3 ubiquitin protein ligase
    • Neural precursor cell expressed, developmentally down regulated 4 like
    • RSP5
    • Ubiquitin protein ligase Rsp5
    see all
  • Function

    E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Inhibits TGF-beta signaling by triggering SMAD2 and TGFBR1 ubiquitination and proteasome-dependent degradation. Promotes ubiquitination and internalization of various plasma membrane channels such as ENaC, Nav1.2, Nav1.3, Nav1.5, Nav1.7, Nav1.8, Kv1.3, EAAT1 or CLC5. Promotes ubiquitination and degradation of SGK1 and TNK2.
  • Tissue specificity

    Ubiquitously expressed, with highest levels in prostate, pancreas and kidney.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 C2 domain.
    Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.
    Contains 4 WW domains.
  • Post-translational
    modifications

    Phosphorylated by SGK1 or PKA; which impairs interaction with SCNN. Interaction with YWHAH inhibits dephosphorylation.
    Auto-ubiquitinated.
  • Cellular localization

    Cytoplasm. May be recruited to exosomes by NDFIP1.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132338 stained with Coomassie Blue.

References

ab132338 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132338.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up