Description

  • Product name

    Recombinant human NEK8 protein
  • Biological activity

    The specific activity of ab204141 was determined to be 5 nmol /min/mg as per activity assay protocol.

  • Purity

    > 75 % SDS-PAGE.
    assessed by densitometry
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEKYERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQN ECQVLKLLNHPNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLL EEETILHFFVQILLALHHVHTHLILHRDLKTQNILLDKHRMVVKIGDFGI SKILSSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLK RAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLSLEPAQRPPLS HIMAQPLCIRALLNLHTDVGSVRMRRAEKSVAPSNTGSRTTSVRCRGIPR GPVRPAIPPPLSSVYAWGGGLG
    • Predicted molecular weight

      66 kDa including tags
    • Amino acids

      1 to 322
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab204141 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab64311 (Myelin Basic Protein protein) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • JCK
    • NEK 8
    • NEK12A
    • NEK8
    • NEK8_HUMAN
    • Nephrocystin 9
    • Never in mitosis A-related kinase 8
    • NIMA (never in mitosis gene a) related kinase 8
    • NIMA related kinase 8
    • NIMA-family kinase NEK8
    • NIMA-related kinase 12a
    • Nima-related protein kinase 12a
    • NimA-related protein kinase 8
    • NPHP9
    • Serine/threonine-protein kinase Nek8
    see all
  • Function

    Required for renal tubular integrity.
  • Tissue specificity

    Highest expression in thyroid, adrenal gland and skin. Low levels in spleen, colon and uterus. Overexpressed in breast tumors, with highest expression in infiltrating ductal carcinomas and moderate levels in mucinous adenocarcinoma.
  • Sequence similarities

    Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
    Contains 1 protein kinase domain.
    Contains 5 RCC1 repeats.
  • Cellular localization

    Cytoplasm. Predominantly cytoplasmic.
  • Information by UniProt

Images

  • Sample Kinase Activity Plot showing ab204141. The specific activity of NEK8 was determined to be 5 nmol /min/mg as per activity assay protocol.

  • SDS-PAGE showing ab204141.

References

ab204141 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204141.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up