Description

  • Product name

    Recombinant human NEK9 protein
    See all NEK9 proteins and peptides
  • Biological activity

    Specific Activity: 147 pmol/min/µg

    Assay Conditions: Enzyme reaction is conducted in a Kinase Buffer (50 mM Tris pH 7.4, 20 mM MgCl2, 0.1 mg/ml BSA and 1 mM DTT) containing 20 µM ATP and 0.2 mg/ml MBP for 30 minutes at 30°C. 

  • Purity

    >= 38 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDPLVPRGSPGEFMSVLGEYERHCDSINSDFG SESGGCGDSSPGPSASQGPRAGGGAAEQEELHYIPIRVLGRGAFGEATLY RRTEDDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFM DNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHK AGILHRDIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMS PELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRA MEVDSSQYSLELIQMVHSCLDQDPEQRPTADELLDRPLLRKRRREMEEKV TLLNAPTKRPRSSTVTEAPIAVVTSRTKTIRSNSSGLSIGTVFQSSSPGG GGGGGGGEEEDSQQESETPDPSGGFRGTMEADRGMEGLISPTEAMGNSNG ASSSCPGWLRKELENAEFIPMPDSPSPLSAAFSESEKDTLPYEELQGLKV ASEAPLEHKPQVEASSPRLNPAVTCAGKGTPLTPPACACSSLQVEVERLQ GLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEE MEMDPKPDLDSDSWCLLGTDSCRPSL
    • Predicted molecular weight

      92 kDa including tags
    • Amino acids

      1 to 979
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      Truncated NEK9 protein aa1-979 with deleted fragment of aa 346-731

Specifications

Our Abpromise guarantee covers the use of ab196083 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Glutathione, 0.05% DTT, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • KIAA1995
    • APUG
    • DKFZp434D0935
    • LCCS10
    • MGC138306
    • MGC16714
    • NC
    • NEK 9
    • Nek8
    • nek9
    • NEK9_HUMAN
    • NERCC
    • Nercc 1 kinase
    • NERCC1
    • Nercc1 kinase
    • Never in mitosis A related kinase 9
    • Never in mitosis A-related kinase 9
    • NIMA (never in mitosis gene a) related kinase 9
    • NIMA related kinase 8
    • NIMA related kinase 9
    • NIMA related kinase Nek8
    • NimA related protein kinase 9
    • NIMA-related kinase 8
    • NimA-related protein kinase 9
    • Serine/threonine protein kinase Nek9
    • Serine/threonine-protein kinase Nek9
    see all
  • Function

    Pleiotropic regulator of mitotic progression, participating in the control of spindle dynamics and chromosome separation. Phosphorylates different histones, myelin basic protein, beta-casein, and BICD2. Phosphorylates histone H3 on serine and threonine residues and beta-casein on serine residues. Important for G1/S transition and S phase progression.
  • Tissue specificity

    Most abundant in heart, liver, kidney and testis. Also expressed in smooth muscle cells and fibroblasts.
  • Sequence similarities

    Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
    Contains 1 protein kinase domain.
    Contains 6 RCC1 repeats.
  • Developmental stage

    Expression varied mildly across the cell cycle, with highest expression observed in G1 and stationary-phase cells.
  • Domain

    Dimerizes through its coiled-coil domain.
  • Post-translational
    modifications

    Autophosphorylated on serine and threonine residues. When complexed with FACT, exhibits markedly elevated phosphorylation on Thr-210. During mitosis, not phosphorylated on Thr-210. Phosphorylated by CDK1 in vitro.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • Specific activity of ab196083 was determined to be 147 pmol/min/μg

  • 10% SDS-PAGE analysis of ab196083 (1.1µg) stained with Coomassie Blue.

References

ab196083 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196083.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up