Overview

  • Product name

    Recombinant Human NELF-B protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQA LFGDEVSPLLKQYILEKESALFSTELSVLHNFFSPSPKTRRQGEVVQRLT RMVGKNVKLYDMVLQFLRTLFLRTRNVHYCTLRAELLMSLHDLDVGEICT VDPCHKFTWCLDACIRERFVDSKRARELQGFLDGVKKGQEQVLGDLSMIL CDPFAINTLALSTVRHLQELVGQETLPRDSPDLLLLLRLLALGQGAWDMI DSQVFKEPKMEVELITRFLPMLMSFLVDDYTFNVDQKLPAEEKAPVSYPN TLPESFTKFLQEQRMACEVGLYYVLHITKQRNKNALLRLLPGLVETFGDL AFGDIFLHLLTGNLALLADEFALEDFCSSLFDGFFLTASPRKENVHRHAL RLLIHLHPRVAPSKLEALQKALEPTGQSGEAVKELYSQLGEKLEQLDHRK PSPAQAAETPALELPLPSVPAPAPL
    • Molecular weight

      78 kDa including tags
    • Amino acids

      106 to 580

Specifications

Our Abpromise guarantee covers the use of ab132528 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    The protein is best used within three months from the date of receipt.

    Previously labelled as COBRA1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A730008L03Rik
    • AB041607
    • AI663983
    • Cobra1
    • Cofactor of BRCA1
    • DKFZp586B0519
    • KIAA1182
    • Negative elongation factor B
    • Negative elongation factor protein B
    • Nelf b
    • NELF-B
    • NELFB
    • RGD1307832
    • RP13-122B23.3
    • RP23-132N23.4
    see all
  • Relevance

    NELF-B is an essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex causes transcriptional pausing and is counteracted by the P-TEFb kinase complex. It may be able to induce chromatin unfolding.
  • Cellular localization

    Nuclear

Images

  • 12.5% SDS-PAGE analysis of ab132528 stained with Coomassie Blue.

References

ab132528 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132528.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up