Description

  • Product name

    Recombinant Human Nephrin protein (His tag)
    See all Nephrin proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLG PDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL VSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDIT ILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSP ALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRA
    • Predicted molecular weight

      29 kDa including tags
    • Amino acids

      23 to 257
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab235806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • CNF
    • Nephrin
    • Nephrosis 1 congenital Finnish type
    • Nephrosis 1, congenital, Finnish type (nephrin)
    • NPHN
    • NPHN_HUMAN
    • NPHS 1
    • Nphs1
    • Renal glomerulus specific cell adhesion receptor
    • Renal glomerulus-specific cell adhesion receptor
    see all
  • Function

    Seems to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion.
  • Tissue specificity

    Specifically expressed in podocytes of kidney glomeruli.
  • Involvement in disease

    Defects in NPHS1 are the cause of nephrotic syndrome type 1 (NPHS1) [MIM:256300]; also known as Finnish congenital nephrosis (CNF). A renal disease characterized clinically by proteinuria, hypoalbuminemia, hyperlipidemia, and edema. Kidney biopsies show non-specific histologic changes such as focal segmental glomerulosclerosis and diffuse mesangial proliferation. Some affected individuals have an inherited steroid-resistant form and progress to end-stage renal failure.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
    Contains 1 fibronectin type-III domain.
    Contains 8 Ig-like C2-type (immunoglobulin-like) domains.
  • Developmental stage

    In 23-week-old embryo found in epithelial podocytes of the periphery of mature and developing glomeruli.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues.
  • Cellular localization

    Cell membrane. Predominantly located at podocyte slit diaphragm between podocyte foot processes. Also associated with podocyte apical plasma membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235806.

References

ab235806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up