Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RAAIAPFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRASTVSSVTQ VEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV
    • Amino acids
      443 to 542
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160922 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARHG8_HUMAN
    • ARHGEF8
    • GLYT2
    • Guanine nucleotide regulatory protein oncogene
    • MGC114559
    • MGC127767
    • MGC53602
    • mNET1
    • Net1
    • NET1A
    • Neuroepithelial cell transforming gene 1
    • Neuroepithelial cell-transforming gene 1 protein
    • p65 Net1 proto oncogene
    • Proto-oncogene p65 Net1
    • Rho guanine nucleotide exchange factor 8
    • Rho guanine nucleotide exchange factor GEF 8
    see all
  • Function
    Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. May be involved in activation of the SAPK/JNK pathway Stimulates genotoxic stress-induced RHOB activity in breast cancer cells leading to their cell death.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab160922 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160922 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160922.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up