Description

  • Product name

    Recombinant Human Netrin 1 protein
    See all Netrin 1 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      YAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIAC KCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQ REKKGKCKKA
    • Amino acids

      495 to 604
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • epididymis tissue protein Li 131P
    • NET1_HUMAN
    • Netrin 1, mouse, homolog of
    • Netrin 1-like
    • Netrin-1
    • Netrin1
    • Ntn 1
    • NTN 1L
    • NTN1
    • NTN1L
    • Unc6
    see all
  • Function

    Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either DCC or some UNC5 receptors will lead to axon attraction or repulsion, respectively. It also serve as a survival factor via its association with its receptors which prevent the initiation of apoptosis. Involved in tumorigenesis by regulating apoptosis.
  • Tissue specificity

    Widely expressed in normal adult tissues with highest levels in heart, small intestine, colon, liver and prostate. Reduced expression in brain tumors and neuroblastomas.
  • Sequence similarities

    Contains 3 laminin EGF-like domains.
    Contains 1 laminin N-terminal domain.
    Contains 1 NTR domain.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab152983 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up