Description

  • Product name

    Recombinant Human Netrin G2 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCS HENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPL
    • Amino acids

      21 to 119
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bA479K20.1
    • bA479K20.1 (novel protein)
    • KIAA0625
    • KIAA1857
    • laminet 2
    • Laminet-2
    • LHLL9381
    • Lmnt2
    • MGC21884
    • Netrin G1
    • Netrin-G2
    • NTNG1
    • NTNG2
    • NTNG2_HUMAN
    see all
  • Function

    Promotes neurite outgrowth of both axons and dendrites.
  • Sequence similarities

    Contains 3 laminin EGF-like domains.
    Contains 1 laminin N-terminal domain.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab164622 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up