Overview

  • Product name
    Recombinant Human Neurabin 1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PCSTAQTSTRSPCMPFSWFNDSRKGSYSFRNLPAPTSSLQPSPETLISDK KGSKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMI
    • Amino acids
      1090 to 1188
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163141 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ20068
    • KIAA1222
    • NEB1_HUMAN
    • Neurabin I
    • Neurabin-1
    • Neurabin-I
    • Neurabin1
    • NeurabinI
    • Neural tissue specific F actin binding protein I
    • Neural tissue-specific F-actin-binding protein I
    • NRB 1
    • NRB I
    • NRB1
    • NRBI
    • Ppp1r9a
    • Protein phosphatase 1 regulatory (inhibitor) subunit 9A
    • Protein phosphatase 1 regulatory subunit 9A
    see all
  • Function
    Binds to actin filaments (F-actin) and shows cross-linking activity. Binds along the sides of the F-actin. May be involved in neurite formation. Inhibits protein phosphatase 1-alpha activity.
  • Sequence similarities
    Contains 1 PDZ (DHR) domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Domain
    Interacts with p70-S6K via its PDZ domain.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell junction > synapse > synaptosome.
  • Information by UniProt

Images

  • ab163141 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163141 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163141.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up