Description

  • Product name

    Recombinant Human Neurexin 1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLE LILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFI
    • Amino acids

      31 to 130
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp313P2036
    • FLJ35941
    • Hs.22998
    • KIAA0578
    • Neurexin 1 alpha
    • Neurexin 1 beta
    • Neurexin I-alpha
    • Neurexin-1
    • Neurexin-1-alpha
    • NRX1A_HUMAN
    • NRXN1
    • PTHSL2
    • SCZD17
    see all
  • Function

    Cell surface protein involved in cell-cell-interactions, exocytosis of secretory granules and regulation of signal transmission. Function is isoform-specific. Alpha-type isoforms have a long N-terminus with six laminin G-like domains and play an important role in synaptic signal transmission. Alpha-type isoforms play a role in the regulation of calcium channel activity and Ca(2+)-triggered neurotransmitter release at synapses and at neuromuscular junctions. They play an important role in Ca(2+)-triggered exocytosis of secretory granules in pituitary gland. They may effect their functions at synapses and in endocrine cells via their interactions with proteins from the exocytotic machinery. Likewise, alpha-type isoforms play a role in regulating the activity of postsynaptic NMDA receptors, a subtype of glutamate-gated ion channels. Both alpha-type and beta-type isoforms may play a role in the formation or maintenance of synaptic junctions via their calcium-dependent interactions (via the extracellular domains) with neuroligin family members, CBLN1 or CBLN2. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Alpha-type isoforms were first identified as receptors for alpha-latrotoxin from spider venom.
  • Tissue specificity

    Brain.
  • Sequence similarities

    Belongs to the neurexin family.
    Contains 3 EGF-like domains.
    Contains 6 laminin G-like domains.
  • Post-translational
    modifications

    N-glycosylated.
    O-glycosylated.
  • Cellular localization

    Cell membrane. Cell junction, synapse. Localized on the pre-synaptic membrane.
  • Information by UniProt

Images

  • ab160463 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:

  • Shen H  et al. Role of Neurexin-1ß and Neuroligin-1 in Cognitive Dysfunction After Subarachnoid Hemorrhage in Rats. Stroke 46:2607-15 (2015). Read more (PubMed: 26219651) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up