Overview

  • Product name

    Recombinant Human NeuroD2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKGDAPPPPPPAPGPGAPG PARAAKPVPLRGEEGTEATLAEVKEEGELGGEEEEEEEEEEGLDEAEGER PKKGGPKKRKMTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPC YSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYVQTLCKGLSQPT TNLVAGCLQLNSRNFLTEQGADGAGRFHGSGGPFAMHPYPYPCSRLAGAQ CQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLS PPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVR GGVHSENLLSYDMHLHHDRGPMYEELNAFFHN
    • Molecular weight

      68 kDa including tags
    • Amino acids

      1 to 382

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bHLHa1
    • class A basic helix loop helix protein 1
    • Class A basic helix-loop-helix protein 1
    • NDF2_HUMAN
    • NDR2
    • NDRF
    • neuroD related factor
    • NeuroD-related factor
    • NeuroD2
    • neurogenic basic helix loop helix protein
    • neurogenic differentiation 2
    • Neurogenic differentiation factor 2
    • neuronal differentiation 2
    see all
  • Function

    Appears to mediate neuronal differentiation.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152568 stained with Coomassie Blue.

References

ab152568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up