Description

  • Product name

    Recombinant Human Neurogenin 1/NEUROG1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKI ETLRFAYNYIWALAETLRLADQGLPGGGARER
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      82 to 163

Specifications

Our Abpromise guarantee covers the use of ab114475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as Neurogenin 1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AKA
    • Ath4c
    • bHLHa6
    • Class A basic helix-loop-helix protein 6
    • Helix loop helix protein mATH 4C
    • MATH4C
    • NeuroD3
    • Neurog 1
    • Neurog1
    • Neurogenic basic helix loop helix protein
    • Neurogenic basic-helix-loop-helix protein
    • Neurogenic differentiation 3
    • Neurogenic differentiation factor 3
    • Neurogenin-1
    • Neurogenin1
    • Ngn
    • NGN-1
    • Ngn1
    • NGN1_HUMAN
    see all
  • Function

    Appears to mediate neuronal differentiation.
  • Tissue specificity

    Expression restricted to the embryonic nervous system.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab114475 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up