Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGG ARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGA KTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTK IETLRFAHNYIWALTETLRLADHCGGGGGGLPGALFSEAVLLSPGGASAA LSSSGDSPSPASTWSCTNSPAPSSSVSSNSTSPYSCTLSPASPAGSDMDY WQPPPPDKHRYAPHLPIARDCI
    • Molecular weight

      55 kDa including tags
    • Amino acids

      1 to 272

Specifications

Our Abpromise guarantee covers the use of ab131781 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.

     This product was previously labelled as Neurogenin 2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Atoh 4
    • Atoh4
    • bHLHa8
    • Class A basic helix-loop-helix protein 8
    • Math 4A
    • Math4A
    • MGC
    • MGC46562
    • NEUROG 2
    • NEUROG2
    • Neurogenin-2
    • Neurogenin2
    • NGN 2
    • NGN-2
    • NGN2
    • NGN2_HUMAN
    • Protein atonal homolog 4
    see all
  • Function

    Involved in neurogenesis.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131781 stained with Coomassie Blue.

References

ab131781 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131781.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up