Overview

  • Product name
    Recombinant Human Neuroglycan C protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNDDPSAPHK IQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT
    • Amino acids
      445 to 539
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161105 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acidic leucine rich EGF like domain containing brain protein
    • Acidic leucine-rich EGF-like domain-containing brain protein
    • Caleb
    • Chondroitin sulfate proteoglycan 5
    • Chondroitin sulfate proteoglycan 5 (neuroglycan C)
    • CSPG5
    • CSPG5_HUMAN
    • MGC44034
    • Neuroglycan C
    • Ngc
    • OTTHUMP00000164796
    • OTTHUMP00000164797
    • OTTHUMP00000210429
    see all
  • Function
    May function as a growth and differentiation factor involved in neuritogenesis. May induce ERBB3 activation.
  • Tissue specificity
    Restricted to brain (at protein level).
  • Sequence similarities
    Contains 1 EGF-like domain.
  • Developmental stage
    Expressed in brain of 3 months, 5 and 10-year-old individuals.
  • Post-translational
    modifications
    N-glycosylated.
    O-glycosylated; contains chondroitin sulfate glycans. Part-time proteoglycan, expressed in part as a proteoglycan exhibiting chondroitin sulfate glycans and in part as a non-proteoglycan form. The relative amount of both forms depends on tissues and tissues maturation.
    Phosphorylated; in intracellular and extracellular parts.
  • Cellular localization
    Cell membrane. Endoplasmic reticulum membrane. Golgi apparatus membrane. In neurons, localizes to synaptic junctions (By similarity). Also detected in the endoplasmic reticulum and the Golgi (By similarity). Partially enriched in lipid rafts.
  • Information by UniProt

Images

  • ab161105 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161105 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161105.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up