Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTT KVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELS
    • Amino acids
      578 to 677
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161450 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NLG 1
    • KIAA1070
    • MGC45115
    • Neuroligin-1
    • NL1
    • NLG1
    • Nlgn1
    • NLGN1_HUMAN
    see all
  • Function
    Neuronal cell surface protein thought to be involved in cell-cell-interactions by forming intercellular junctions through binding to beta-neurexins. Seems to play role in formation or maintenance of synaptic junctions. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses.
  • Tissue specificity
    Expressed in the blood vessel walls (at protein level).
  • Sequence similarities
    Belongs to the type-B carboxylesterase/lipase family.
  • Cellular localization
    Cell membrane. Cell junction > synapse. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Enriched in synaptic plasma membranes and clustered in synaptic clefts and postsynaptic densities.
  • Information by UniProt

Images

  • ab161450 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:
  • Shen H  et al. Role of Neurexin-1ß and Neuroligin-1 in Cognitive Dysfunction After Subarachnoid Hemorrhage in Rats. Stroke 46:2607-15 (2015). Read more (PubMed: 26219651) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161450.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up